General Information

    • DRAMP ID

    • DRAMP03094

    • Peptide Name

    • Drosomycin-2 (Insects, animals)

    • Source

    • Drosophila melanogaster (Fruit fly)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal, Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03094 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03094.

Physicochemical Information

    • Formula

    • C204H317N61O63S9

    • Absent Amino Acids

    • FQT

    • Common Amino Acids

    • C

    • Mass

    • 4920.67

    • PI

    • 6.86

    • Basic Residues

    • 8

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -78.94

    • Hydrophobicity

    • -0.511

    • Aliphatic Index

    • 44.32

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12990

    • Absorbance 280nm

    • 302.09

    • Polar Residues

    • 19

DRAMP03094

DRAMP03094 chydropathy plot

Comments Information

    • Function

    • Drosomycin-2 is antiparasitic peptide which shows inhibitory effect on the ookinete development of the parasite Plasmodium berghei.

    • Induction

    • Expressed in larva, pupa and adult.

Literature Information

  • ·Literature 1

    • Title

    • Gene expression, antiparasitic activity, and functional evolution of the drosomycin family.

    • Reference

    • Mol Immunol. 2008 Sep;45(15):3909-3916.

    • Author

    • Tian C, Gao B, Rodriguez Mdel C, Lanz-Mendoza H, Ma B, Zhu S.