• DRAMP ID

    • DRAMP03095
    • Peptide Name

    • Andropin (Insects, animals)
    • Source

    • Drosophila melanogaster (Fruit fly)
    • Family

    • Not found
    • Gene

    • Anp
    • Sequence

    • VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
    • Sequence Length

    • 34
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Escherichia coli D21 (MIC=140 µM), Enterobacter cloacae b312 (MIC>300 µM), Pseudomonas aeruginosa OT97 (MIC>300 µM), Serratia marcescens Db 11 (MIC>127 µM), Serratia marcescens Db 1140 (MIC>127 µM);
      • Gram-positive bacteria: Bacillus megatherium Bml1 (MIC=11 µM), Bacillus subtilis Bs11 (MIC=17 µM), Micrococcus luteus MIll (MIC=20 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03095 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03095.
    • Formula

    • C175H278N44O47
    • Absent Amino Acids

    • CMRSTWY
    • Common Amino Acids

    • I
    • Mass

    • 3750.4
    • PI

    • 6.73
    • Basic Residues

    • 5
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +1
    • Boman Index

    • -18.76
    • Hydrophobicity

    • 0.221
    • Aliphatic Index

    • 117.65
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 5

DRAMP03095

DRAMP03095 chydropathy plot
    • Andropin is constitutively expressed in the adult male ejaculatory duct in response to mating not bacterial infection. Andropin is less fungicidal than the cecropins (Insect Biochem Mol Biol. 1999;29

    • 965-72). Along with other antimicrobial proteins, this peptide sterilizes the reproduction system of insects and protects sperms from being infected by bacteria (J Insect Physiol. 2001 Jun;47(6)
  • ·Literature 1
    • Title

    • The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster.
    • Reference

    • EMBO J. 1991; 10:163-169.
    • Author

    • Samakovlis, C, Kylsten, P, Kimbrell, DA, Engstroem, A, Hultmark, D.