General Information

    • DRAMP ID

    • DRAMP03095

    • Peptide Name

    • Andropin (Insects, animals)

    • Source

    • Drosophila melanogaster (Fruit fly)

    • Family

    • Not found

    • Gene

    • Anp

    • Sequence

    • VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli D21 (MIC=140 µM), Enterobacter cloacae b312 (MIC>300 µM), Pseudomonas aeruginosa OT97 (MIC>300 µM), Serratia marcescens Db 11 (MIC>127 µM), Serratia marcescens Db 1140 (MIC>127 µM);
      • Gram-positive bacteria: Bacillus megatherium Bml1 (MIC=11 µM), Bacillus subtilis Bs11 (MIC=17 µM), Micrococcus luteus MIll (MIC=20 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03095 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C175H278N44O47

    • Absent Amino Acids

    • CMRSTWY

    • Common Amino Acids

    • I

    • Mass

    • 3750.4

    • PI

    • 6.73

    • Basic Residues

    • 5

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +1

    • Boman Index

    • -18.76

    • Hydrophobicity

    • 0.221

    • Aliphatic Index

    • 117.65

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 5

DRAMP03095

DRAMP03095 chydropathy plot

Comments Information

    • Andropin is constitutively expressed in the adult male ejaculatory duct in response to mating not bacterial infection. Andropin is less fungicidal than the cecropins (Insect Biochem Mol Biol. 1999;29

    • 965-72). Along with other antimicrobial proteins, this peptide sterilizes the reproduction system of insects and protects sperms from being infected by bacteria (J Insect Physiol. 2001 Jun;47(6)

Literature Information

  • ·Literature 1

    • Title

    • The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster.

    • Reference

    • EMBO J. 1991; 10:163-169.

    • Author

    • Samakovlis, C, Kylsten, P, Kimbrell, DA, Engstroem, A, Hultmark, D.