General Information

    • DRAMP ID

    • DRAMP03103

    • Peptide Name

    • Sarcotoxin-1D (Sarcotoxin ID; Insects, animals)

    • Source

    • Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • GWIRDFGKRIERVGQHTRDATIQTIAVAQQAANVAATLKG

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus, Bacillus subtilis, Mycobacterium smegmatis, Corynebacterium bouis, Corynebacterium michiganense.
      • Gram-negagtive bacteria: Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli, Shigella sonnei, Proteus vulgaris.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03103 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03103.

Physicochemical Information

    • Formula

    • C189H312N62O56

    • Absent Amino Acids

    • CMPSY

    • Common Amino Acids

    • A

    • Mass

    • 4348.94

    • PI

    • 10.83

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +4

    • Boman Index

    • -80.31

    • Hydrophobicity

    • -0.313

    • Aliphatic Index

    • 88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 141.03

    • Polar Residues

    • 9

DRAMP03103

DRAMP03103 chydropathy plot

Comments Information

    • Function

    • Sarcotoxins, which are potent bactericidal proteins, are produced in response to injury. They are cytotoxic to both Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Purification of three antibacterial proteins from the culture medium of NIH-Sape-4, an embryonic cell line of Sarcophaga peregrina.

    • Reference

    • J Biol Chem. 1988 Nov 15;263(32):17112-17116.

    • Author

    • Matsuyama K, Natori S.