• DRAMP ID

    • DRAMP03103
    • Peptide Name

    • Sarcotoxin-1D (Sarcotoxin ID; Insects, animals)
    • Source

    • Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina)
    • Family

    • Belongs to the cecropin family
    • Gene

    • Not found
    • Sequence

    • GWIRDFGKRIERVGQHTRDATIQTIAVAQQAANVAATLKG
    • Sequence Length

    • 40
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus FDA209P-
        Staphylococcus smith-
        Micrococcus luteus-
        Bacillus subtilis-
        Mycobacterium smegmatis-
        Corynebacterium bouis-
        Corynebacterium michiganense-
      • Gram-negagtive bacteria: Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli, Shigella sonnei, Proteus vulgaris.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03103 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03103.
    • Formula

    • C189H312N62O56
    • Absent Amino Acids

    • CMPSY
    • Common Amino Acids

    • A
    • Mass

    • 4348.94
    • PI

    • 10.83
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +4
    • Boman Index

    • -80.31
    • Hydrophobicity

    • -0.313
    • Aliphatic Index

    • 88
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 141.03
    • Polar Residues

    • 9

DRAMP03103

DRAMP03103 chydropathy plot
    • Function

    • Sarcotoxins, which are potent bactericidal proteins, are produced in response to injury. They are cytotoxic to both Gram-positive and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Purification of three antibacterial proteins from the culture medium of NIH-Sape-4, an embryonic cell line of Sarcophaga peregrina.
    • Reference

    • J Biol Chem. 1988 Nov 15;263(32):17112-17116.
    • Author

    • Matsuyama K, Natori S.