General Information

    • DRAMP ID

    • DRAMP03107

    • Peptide Name

    • Andropin (Insects, animals)

    • Source

    • Drosophila teissieri (Fruit fly)

    • Family

    • Not found

    • Gene

    • Anp

    • Sequence

    • FINLLDKVEDALHTGAQAGFKLIRPVERGATPKKSEKPEK

    • Sequence Length

    • 40

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03107 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03107.

Physicochemical Information

    • Formula

    • C199H328N56O58

    • Absent Amino Acids

    • CMWY

    • Common Amino Acids

    • K

    • Mass

    • 4433.13

    • PI

    • 9.31

    • Basic Residues

    • 9

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +3

    • Boman Index

    • -79.58

    • Hydrophobicity

    • -0.66

    • Aliphatic Index

    • 83

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 7

DRAMP03107

DRAMP03107 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila.

    • Reference

    • J Mol Evol. 2002 May;54(5):665-670.

    • Author

    • Date-Ito A, Kasahara K, Sawai H, Chigusa SI.