• DRAMP ID

    • DRAMP03119
    • Peptide Name

    • Def-BAT (hybrid defensins; Insects, animals)
    • Source

    • Anopheles gambiae (African malaria mosquito)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ATCDLASFSSQWVTPNDSLCAAHCIARRYRGGYCNGKRVCVCR
    • Sequence Length

    • 43
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus strain 21IC90=6.25 µg/mL
        Staphylococcus aureus strain 4IC90=6.25 µg/mL
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix (1 helices; 7 residues)
    • Structure Description

    • For Def-BAT, the two extended strands do not form an anti-parallel β-sheet. The helix is separated from the β-sheet by a turn (T1) and the two strands of the b-sheet by turn T2.
    • Helical Wheel Diagram

    • DRAMP03119 helical wheel diagram
    • PDB ID

    • 2E3F resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP03119.
    • Formula

    • C198H313N65O59S6
    • Absent Amino Acids

    • EM
    • Common Amino Acids

    • C
    • Mass

    • 4740.42
    • PI

    • 8.94
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +5
    • Boman Index

    • -88.35
    • Hydrophobicity

    • -0.151
    • Aliphatic Index

    • 59.07
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 210.83
    • Polar Residues

    • 19

DRAMP03119

DRAMP03119 chydropathy plot
    • Function

    • Responsible for the anti Gram-positive activity of immune hemolymph and proves to be efficient against sensitive
    • strains as against resistant and multi-resistant strains.

  • ·Literature 1
    • Title

    • Rational design of peptides active against the gram positive bacteria Staphylococcus aureus.
    • Reference

    • Proteins. 2008 Jul;72(1):229-239.
    • Author

    • Landon C, Barbault F, Legrain M, Guenneugues M, Vovelle F.