• DRAMP ID

    • DRAMP03123
    • Peptide Name

    • Cecropin-B (AgCecB; Insects, animals)
    • Source

    • Anopheles gambiae (African malaria mosquito)
    • Family

    • Belongs to the cecropin family
    • Gene

    • CecB
    • Sequence

    • APRWKFGKRLEKLGRNVFRAAKKALPVIAGYKAL
    • Sequence Length

    • 34
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03123 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03123.
    • Formula

    • C181H298N54O39
    • Absent Amino Acids

    • CDHMQST
    • Common Amino Acids

    • AK
    • Mass

    • 3854.7
    • PI

    • 11.61
    • Basic Residues

    • 10
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +9
    • Boman Index

    • -51.92
    • Hydrophobicity

    • -0.309
    • Aliphatic Index

    • 92.06
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6990
    • Absorbance 280nm

    • 211.82
    • Polar Residues

    • 5

DRAMP03123

DRAMP03123 chydropathy plot
    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).
  • ·Literature 1
    • Title

    • Genomic organization and regulation of three cecropin genes in Anopheles gambiae.
    • Reference

    • Insect Mol Biol. 2002 Dec;11(6):517-525.
    • Author

    • Zheng XL, Zheng AL.