General Information

    • DRAMP ID

    • DRAMP03123

    • Peptide Name

    • Cecropin-B (AgCecB; Insects, animals)

    • Source

    • Anopheles gambiae (African malaria mosquito)

    • Family

    • Belongs to the cecropin family

    • Gene

    • CecB

    • Sequence

    • APRWKFGKRLEKLGRNVFRAAKKALPVIAGYKAL

    • Sequence Length

    • 34

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03123 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03123.

Physicochemical Information

    • Formula

    • C181H298N54O39

    • Absent Amino Acids

    • CDHMQST

    • Common Amino Acids

    • AK

    • Mass

    • 3854.7

    • PI

    • 11.61

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +9

    • Boman Index

    • -51.92

    • Hydrophobicity

    • -0.309

    • Aliphatic Index

    • 92.06

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 211.82

    • Polar Residues

    • 5

DRAMP03123

DRAMP03123 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Genomic organization and regulation of three cecropin genes in Anopheles gambiae.

    • Reference

    • Insect Mol Biol. 2002 Dec;11(6):517-525.

    • Author

    • Zheng XL, Zheng AL.