General Information

    • DRAMP ID

    • DRAMP03126

    • Peptide Name

    • Antimicrobial peptide defensin 3 (AgDef3; Insects, animals)

    • Source

    • Anopheles gambiae (African malaria mosquito)

    • Family

    • Not found

    • Gene

    • Def3

    • Sequence

    • QLKNLACVTNEGPKWANTYCAAVCHMSGRGAGSCNAKDECVCSMT

    • Sequence Length

    • 45

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03126 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03126.

Physicochemical Information

    • Formula

    • C192H309N59O64S8

    • Absent Amino Acids

    • FI

    • Common Amino Acids

    • AC

    • Mass

    • 4724.4

    • PI

    • 7.78

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +2

    • Boman Index

    • -57.43

    • Hydrophobicity

    • -0.167

    • Aliphatic Index

    • 50

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 167.39

    • Polar Residues

    • 21

DRAMP03126

DRAMP03126 chydropathy plot

Comments Information

    • Function

    • Antibacterial peptide mostly active against Gram-positive bacteria with atypical up-regulation of expression. Developmental stage

    • Induction

    • Not induced in 4th instar larvae following a blood meal, an infected blood meal, sterile injection or bacterial injection (E.coli K12 RM148 and M.luteus).

    • PTM

    • Contains three disulfide bonds 7-34; 20-39; 24-42.

Literature Information

  • ·Literature 1

    • Title

    • The malaria vector mosquito Anopheles gambiae expresses a suite of larval-specific defensin genes.

    • Reference

    • Insect Mol Biol. 2008 Apr;17(2):103-112.

    • Author

    • Meredith JM, Hurd H, Lehane MJ, Eggleston P.
  • ·Literature 2

    • Title

    • The sialotranscriptome of adult male Anopheles gambiae mosquitoes.

    • Reference

    • Insect Biochem Mol Biol. 2006 Jul;36(7):570-575.

    • Author

    • Calvo E, Pham VM, Lombardo F, Arcà B, Ribeiro JM.