• DRAMP ID

    • DRAMP03128
    • Peptide Name

    • Cecropin-B1 (Insects, animals)
    • Source

    • Culex pipiens pipiens (Northern house mosquito)
    • Family

    • Not found
    • Gene

    • CECB1
    • Sequence

    • GRLKKLGKKIEKAGKRVFNAVQKGLPVAAGVQAL
    • Sequence Length

    • 34
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03128 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03128.
    • Formula

    • C162H286N50O40
    • Absent Amino Acids

    • CDHMSTWY
    • Common Amino Acids

    • K
    • Mass

    • 3574.36
    • PI

    • 11.3
    • Basic Residues

    • 9
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +8
    • Boman Index

    • -35.73
    • Hydrophobicity

    • -0.165
    • Aliphatic Index

    • 106.18
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 6

DRAMP03128

DRAMP03128 chydropathy plot
    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).
  • ·Literature 1
    • Title

    • Innate immunity in the Culex pipiens-Wuchereria bancrofti host-parasite relationship
    • Reference

    • Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases.
    • Author

    • Bartholomay L.C, Farid H.A, Ramzy R.M, Christensen B.M.