General Information

    • DRAMP ID

    • DRAMP03128

    • Peptide Name

    • Cecropin-B1 (Insects, animals)

    • Source

    • Culex pipiens pipiens (Northern house mosquito)

    • Family

    • Not found

    • Gene

    • CECB1

    • Sequence

    • GRLKKLGKKIEKAGKRVFNAVQKGLPVAAGVQAL

    • Sequence Length

    • 34

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03128 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03128.

Physicochemical Information

    • Formula

    • C162H286N50O40

    • Absent Amino Acids

    • CDHMSTWY

    • Common Amino Acids

    • K

    • Mass

    • 3574.36

    • PI

    • 11.3

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +8

    • Boman Index

    • -35.73

    • Hydrophobicity

    • -0.165

    • Aliphatic Index

    • 106.18

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 6

DRAMP03128

DRAMP03128 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Innate immunity in the Culex pipiens-Wuchereria bancrofti host-parasite relationship

    • Reference

    • Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Bartholomay L.C, Farid H.A, Ramzy R.M, Christensen B.M.