General Information

    • DRAMP ID

    • DRAMP03131

    • Peptide Name

    • Cecropin-B (Insects, animals)

    • Source

    • Aedes albopictus (Asian tiger mosquito)

    • Family

    • Belongs to the cecropin family

    • Gene

    • CECB1 AND CECB2

    • Sequence

    • GGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIG

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03131 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03131.

Physicochemical Information

    • Formula

    • C168H290N46O43

    • Absent Amino Acids

    • CDHMNQW

    • Common Amino Acids

    • K

    • Mass

    • 3642.43

    • PI

    • 10.3

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +7

    • Boman Index

    • -22.42

    • Hydrophobicity

    • -0.16

    • Aliphatic Index

    • 100.29

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 43.82

    • Polar Residues

    • 10

DRAMP03131

DRAMP03131 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity)

    • Developmental stage

    • Expressed within 2 hours after induction and continued to accumulate over 24 hours.

    • Induction

    • By bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and expression of three cecropin cDNAs from a mosquito cell line.

    • Reference

    • FEBS Lett. 1999; 454:147-151.

    • Author

    • Sun D, Eccleston ED, Fallon AM.