• DRAMP ID

    • DRAMP03134
    • Peptide Name

    • Defensin-D (AaeDefD; Insects, animals)
    • Source

    • Aedes aegypti (Yellowfever mosquito)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCPI
    • Sequence Length

    • 40
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Escherichia coli D31;
      • Gram-positive bacterium: Micrococcus luteus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03134 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03134.
    • Formula

    • C166H270N52O52S6
    • Absent Amino Acids

    • EMQW
    • Common Amino Acids

    • CG
    • Mass

    • 4018.65
    • PI

    • 8.35
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +3
    • Boman Index

    • -32.08
    • Hydrophobicity

    • 0.34
    • Aliphatic Index

    • 73.25
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 47.82
    • Polar Residues

    • 19

DRAMP03134

DRAMP03134 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Immunity proteins from mosquito cell lines include three defensin A isoforms from Aedes aegypti and a defensin D from Aedes albopictus.
    • Reference

    • Insect Mol Biol. 1999 Aug;8(3):311-318.
    • Author

    • Gao Y, Hernandez VP, Fallon AM.