General Information

    • DRAMP ID

    • DRAMP03134

    • Peptide Name

    • Defensin-D (AaeDefD; Insects, animals)

    • Source

    • Aedes aegypti (Yellowfever mosquito)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCPI

    • Sequence Length

    • 40

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli D31;
      • Gram-positive bacterium: Micrococcus luteus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03134 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03134.

Physicochemical Information

    • Formula

    • C166H270N52O52S6

    • Absent Amino Acids

    • EMQW

    • Common Amino Acids

    • CG

    • Mass

    • 4018.65

    • PI

    • 8.35

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +3

    • Boman Index

    • -32.08

    • Hydrophobicity

    • 0.34

    • Aliphatic Index

    • 73.25

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 47.82

    • Polar Residues

    • 19

DRAMP03134

DRAMP03134 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Immunity proteins from mosquito cell lines include three defensin A isoforms from Aedes aegypti and a defensin D from Aedes albopictus.

    • Reference

    • Insect Mol Biol. 1999 Aug;8(3):311-318.

    • Author

    • Gao Y, Hernandez VP, Fallon AM.