General Information

    • DRAMP ID

    • DRAMP03135

    • Peptide Name

    • Defensin-B (AaeDefB; Insects, animals)

    • Source

    • Aedes aegypti (Yellowfever mosquito)

    • Family

    • Belongs to the invertebrate defensin family (Type 1 subfamily)

    • Gene

    • DEFB

    • Sequence

    • ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Has three disulfide bonds

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03135 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03135.

Physicochemical Information

    • Formula

    • C164H266N56O54S6

    • Absent Amino Acids

    • EMPW

    • Common Amino Acids

    • CG

    • Mass

    • 4078.62

    • PI

    • 8.35

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -58.55

    • Hydrophobicity

    • 0.078

    • Aliphatic Index

    • 63.5

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 47.82

    • Polar Residues

    • 20

DRAMP03135

DRAMP03135 chydropathy plot

Comments Information

    • Function

    • Antibacterial peptide mostly active against Gram-positive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity: isolation of three novel inducible antibacterial defensins from the vector mosquito, Aedes aegypti.

    • Reference

    • Insect Biochem Mol Biol. 1995 Jul;25(7):867-873.

    • Author

    • Lowenberger C, Bulet P, Charlet M, Hetru C, Hodgeman B, Christensen BM, Hoffmann JA.