General Information
-
DRAMP ID
- DRAMP03135
-
Peptide Name
- Defensin-B (AaeDefB; Insects, animals)
-
Source
- Aedes aegypti (Yellowfever mosquito)
-
Family
- Belongs to the invertebrate defensin family (Type 1 subfamily)
-
Gene
- DEFB
-
Sequence
- ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN
-
Sequence Length
- 40
-
Protein Existence
- Protein level
Activity Information
-
Biological Activity
- Antimicrobial, Antibacterial
-
Target Organism
- No MICs found in DRAMP database
-
Hemolytic Activity
-
- No hemolysis information or data found in the reference(s) presented in this entry
-
Cytotoxicity
- No cytotoxicity information found in the reference(s) presented
-
Binding Target
- Not found
Structure Information
-
Linear/Cyclic
- Cyclic
-
N-terminal Modification
- Free
-
C-terminal Modification
- Free
-
Nonterminal Modifications and Unusual Amino Acids
- Has three disulfide bonds
-
Stereochemistry
- L
-
Structure
- Bridge
-
Structure Description
- Not found
-
Helical Wheel Diagram
-
PDB ID
- None
-
Predicted Structure
- There is no predicted structure for DRAMP03135.
Physicochemical Information
-
Formula
- C164H266N56O54S6
Absent Amino Acids
- EMPW
Common Amino Acids
- CG
Mass
- 4078.62
PI
- 8.35
Basic Residues
- 5
Acidic Residues
- 2
Hydrophobic Residues
- 12
Net Charge
- +3
-
Boman Index
- -58.55
Hydrophobicity
- 0.078
Aliphatic Index
- 63.5
Half Life
-
- Mammalian:4.4 hour
- Yeast:>20 hour
- E.coli:>10 hour
Extinction Coefficient Cystines
- 1865
Absorbance 280nm
- 47.82
Polar Residues
- 20
DRAMP03135
Comments Information
Function
- Antibacterial peptide mostly active against Gram-positive bacteria.
Literature Information
- ·Literature 1
-
Title
- Insect immunity: isolation of three novel inducible antibacterial defensins from the vector mosquito, Aedes aegypti.
-
Pubmed ID
- 7633471
-
Reference
- Insect Biochem Mol Biol. 1995 Jul;25(7):867-873.
-
Author
- Lowenberger C, Bulet P, Charlet M, Hetru C, Hodgeman B, Christensen BM, Hoffmann JA.
