• DRAMP ID

    • DRAMP03135
    • Peptide Name

    • Defensin-B (AaeDefB; Insects, animals)
    • Source

    • Aedes aegypti (Yellowfever mosquito)
    • Family

    • Belongs to the invertebrate defensin family (Type 1 subfamily)
    • Gene

    • DEFB
    • Sequence

    • ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSQKVCVCRN
    • Sequence Length

    • 40
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Has three disulfide bonds
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03135 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03135.
    • Formula

    • C164H266N56O54S6
    • Absent Amino Acids

    • EMPW
    • Common Amino Acids

    • CG
    • Mass

    • 4078.62
    • PI

    • 8.35
    • Basic Residues

    • 5
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +3
    • Boman Index

    • -58.55
    • Hydrophobicity

    • 0.078
    • Aliphatic Index

    • 63.5
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 47.82
    • Polar Residues

    • 20

DRAMP03135

DRAMP03135 chydropathy plot
    • Function

    • Antibacterial peptide mostly active against Gram-positive bacteria.
  • ·Literature 1
    • Title

    • Insect immunity: isolation of three novel inducible antibacterial defensins from the vector mosquito, Aedes aegypti.
    • Reference

    • Insect Biochem Mol Biol. 1995 Jul;25(7):867-873.
    • Author

    • Lowenberger C, Bulet P, Charlet M, Hetru C, Hodgeman B, Christensen BM, Hoffmann JA.