General Information

    • DRAMP ID

    • DRAMP03143

    • Peptide Name

    • AGAP008645-PA (Putative infection responsive short peptide)

    • Source

    • Anopheles gambiae (African malaria mosquito)

    • Family

    • Not found

    • Gene

    • irsp

    • Sequence

    • MKQVCILLAVLLCTAAVADAMVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFF

    • Sequence Length

    • 81

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03143 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03143.

Physicochemical Information

    • Formula

    • C382H605N105O111S12

    • Absent Amino Acids

    • HW

    • Common Amino Acids

    • CA

    • Mass

    • 8829.36

    • PI

    • 8.57

    • Basic Residues

    • 10

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +4

    • Boman Index

    • -82.47

    • Hydrophobicity

    • 0.293

    • Aliphatic Index

    • 72.35

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6585

    • Absorbance 280nm

    • 82.31

    • Polar Residues

    • 32

DRAMP03143

DRAMP03143 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Gambicin: a novel immune responsive antimicrobial peptide from the malaria vector Anopheles gambiae.

    • Reference

    • Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12630-5.

    • Author

    • Vizioli J, Bulet P, Hoffmann JA, Kafatos FC, Müller HM, Dimopoulos G.