• DRAMP ID

    • DRAMP03148
    • Peptide Name

    • Defensin
    • Source

    • Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • DELPEETYQAAVENYRRKRATCDLLSGFGVGDSACAAHCIARRNRGGYCNAKTVCVC
    • Sequence Length

    • 57
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03148 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03148.
    • Formula

    • C258H413N83O84S6
    • Absent Amino Acids

    • MW
    • Common Amino Acids

    • A
    • Mass

    • 6213.98
    • PI

    • 7.77
    • Basic Residues

    • 9
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +2
    • Boman Index

    • -133.39
    • Hydrophobicity

    • -0.4
    • Aliphatic Index

    • 61.75
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 86.52
    • Polar Residues

    • 22

DRAMP03148

DRAMP03148 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Wolbachia neither induces nor suppresses transcripts encoding antimicrobial peptides.
    • Reference

    • Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
    • Author

    • Melinda PM, Kostas B, Scott OL.