General Information

    • DRAMP ID

    • DRAMP03148

    • Peptide Name

    • Defensin

    • Source

    • Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DELPEETYQAAVENYRRKRATCDLLSGFGVGDSACAAHCIARRNRGGYCNAKTVCVC

    • Sequence Length

    • 57

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03148 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03148.

Physicochemical Information

    • Formula

    • C258H413N83O84S6

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • A

    • Mass

    • 6213.98

    • PI

    • 7.77

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +2

    • Boman Index

    • -133.39

    • Hydrophobicity

    • -0.4

    • Aliphatic Index

    • 61.75

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 86.52

    • Polar Residues

    • 22

DRAMP03148

DRAMP03148 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Wolbachia neither induces nor suppresses transcripts encoding antimicrobial peptides.

    • Reference

    • Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases

    • Author

    • Melinda PM, Kostas B, Scott OL.