General Information

    • DRAMP ID

    • DRAMP03149

    • Peptide Name

    • Defensin D

    • Source

    • Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)

    • Family

    • Not found

    • Gene

    • DefD

    • Sequence

    • VPTVICFLAMCLVAITGAYPQEPVLADEAQSVANSLFDELPEESYQAAVENLRLKRATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCPI

    • Sequence Length

    • 96

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03149 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03149.

Physicochemical Information

    • Formula

    • C439H702N120O136S9

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • A

    • Mass

    • 10125.67

    • PI

    • 4.91

    • Basic Residues

    • 8

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 38

    • Net Charge

    • -2

    • Boman Index

    • -76.48

    • Hydrophobicity

    • 0.309

    • Aliphatic Index

    • 93.54

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 52.32

    • Polar Residues

    • 31

DRAMP03149

DRAMP03149 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Immunity proteins from mosquito cell lines include three defensin A isoforms from Aedes aegypti and a defensin D from Aedes albopictus.

    • Reference

    • Insect Mol Biol. 1999 Aug;8(3):311-318.

    • Author

    • Gao Y, Hernandez VP, Fallon AM.