General Information

    • DRAMP ID

    • DRAMP03150

    • Peptide Name

    • Gambicin (Insects, animals)

    • Source

    • Anopheles albimanus (mosquito)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFL

    • Sequence Length

    • 61

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic

    • Target Organism

      • Gram-negative bacterium: E. coli (MIC=6.25-12.5 µM);
      • Gram-positive bacterium: M. luteus (MIC=25-50 µM).
      • Fungus: N. crassa.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys9 and Cys20; Cys12 and Cys32; Cys41 and Cys51,Cys44 and Cys59.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03150 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03150.

Physicochemical Information

    • Formula

    • C289H449N83O87S9

    • Absent Amino Acids

    • HW

    • Common Amino Acids

    • CG

    • Mass

    • 6766.79

    • PI

    • 8.69

    • Basic Residues

    • 9

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -108.83

    • Hydrophobicity

    • -0.195

    • Aliphatic Index

    • 48.03

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6460

    • Absorbance 280nm

    • 107.67

    • Polar Residues

    • 29

DRAMP03150

DRAMP03150 chydropathy plot

Comments Information

    • Function

    • In vitro experiments showed that the 6.8-kDa mature peptide can kill both Gram-positive and Gram-negative bacteria, has a morphogenic effect on a filamentous fungus, and is marginally lethal to Plasmodium berghei ookinetes.

    • Induction

    • Predominantly expressed in the anterior part.

    • PTM

    • Contains four disulfide bridges.

Literature Information

  • ·Literature 1

    • Title

    • Gambicin: a novel immune responsive antimicrobial peptide from the malaria vector Anopheles gambiae.

    • Reference

    • Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12630-5.

    • Author

    • Vizioli J, Bulet P, Hoffmann JA, Kafatos FC, Müller HM, Dimopoulos G.