• DRAMP ID

    • DRAMP03150
    • Peptide Name

    • Gambicin (Insects, animals)
    • Source

    • Anopheles albimanus (mosquito)
    • Family

    • Unknown
    • Gene

    • Unknown
    • Sequence

    • MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFL
    • Sequence Length

    • 61
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Antifungal, Antiparasitic, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • Gram-negative bacterium: E. coli (MIC=6.25-12.5 µM);
      • Gram-positive bacterium: M. luteus (MIC=25-50 µM).
      • Fungus: N. crassa.
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Bridge
    • Structure Description

    • Unknown
    • DRAMP03150 helical wheel diagram
    • Formula

    • C289H449N83O87S9
    • Absent Amino Acids

    • HW
    • Common Amino Acids

    • CG
    • Mass

    • 7837.19
    • PI

    • 8.4
    • Basic Residues

    • 9
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 15
    • Boman Index

    • -108.83
    • Hydrophobicity

    • -19.51
    • Aliphatic Index

    • 48.03
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6460
    • Absorbance 280nm

    • 107.67
    • Polar Residues

    • 29

DRAMP03150

DRAMP03150 chydropathy plot
    • Function

    • In vitro experiments showed that the 6.8-kDa mature peptide can kill both Gram-positive and Gram-negative bacteria, has a morphogenic effect on a filamentous fungus, and is marginally lethal to Plasmodium berghei ookinetes.
    • Induction

    • Predominantly expressed in the anterior part.
    • PTM

    • Contains four disulfide bridges.
  • Literature 1
    • Reference

    • Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12630-5.
    • Author

    • Vizioli J, Bulet P, Hoffmann JA, Kafatos FC, Müller HM, Dimopoulos G.
    • Title

    • Gambicin: a novel immune responsive antimicrobial peptide from the malaria vector Anopheles gambiae.