General Information

    • DRAMP ID

    • DRAMP03152

    • Peptide Name

    • Spodoptera cecropins B (insects, invertebrates, animals)

    • Source

    • Spodoptera litura larvae (Common cutworm)

    • Family

    • Belongs to the cecropin family

    • Gene

    • CECB

    • Sequence

    • RWKVFKKIEKMGRNIRDGIVKAGPAIEVLGSAKALGK

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03152 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03152.

Physicochemical Information

    • Formula

    • C184H315N55O46S

    • Absent Amino Acids

    • CHQTY

    • Common Amino Acids

    • K

    • Mass

    • 4065.93

    • PI

    • 10.71

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +7

    • Boman Index

    • -54.75

    • Hydrophobicity

    • -0.27

    • Aliphatic Index

    • 97.57

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 152.78

    • Polar Residues

    • 7

DRAMP03152

DRAMP03152 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

    • Induction

    • Induced as part of the humoral response to a bacterial invasion. Transcripts appear within the immunized fat body.

    • Tissue specificity

    • Expressed in immunized fat body.

    • NOTE

    • It retains antibacterial activities in all conditions tested (at pH 5.6-8.0 and in the presence of 50-150 mM NaCl) that was adapted to confirm the antibacterial properties of Spodoptera cecropins.

Literature Information

  • ·Literature 1

    • Title

    • Antibacterial properties and partial cDNA sequences of cecropin-like antibacterial peptides from the common cutworm, Spodoptera litura.

    • Reference

    • Comp Biochem Physiol C Toxicol Pharmacol. 2000 Mar;125(3):287-297.

    • Author

    • Choi CS, Lee IH, Kim E, Kim SI, Kim HR.