• DRAMP ID

    • DRAMP03154
    • Peptide Name

    • Hadrurin (Non-disulfide-bridged peptide 3.1)
    • Source

    • Hadrurus aztecus
    • Family

    • Belongs to the antimicrobial peptide scorpion family
    • Gene

    • Not found
    • Sequence

    • GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA
    • Sequence Length

    • 41
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Salmonella typhimurium, Klebsiella pneumoniae, Enterobacter cloacae, Pseudomonas aeruginosa, Escherichia coli, Serratia marcescens.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03154 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03154.
    • Formula

    • C199H333N57O57
    • Absent Amino Acids

    • CEFHMY
    • Common Amino Acids

    • K
    • Mass

    • 4436.18
    • PI

    • 10.3
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +5
    • Boman Index

    • -50.08
    • Hydrophobicity

    • -0.2
    • Aliphatic Index

    • 104.63
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11000
    • Absorbance 280nm

    • 275
    • Polar Residues

    • 12

DRAMP03154

DRAMP03154 chydropathy plot
    • Function

    • Has antimicrobial activity. Also shows cytolytic activity when tested in human erythrocytes.
  • ·Literature 1
    • Title

    • Hadrurin, a new antimicrobial peptide from the venom of the scorpion Hadrurus aztecus.
    • Reference

    • Eur J Biochem. 2000 Aug;267(16):5023-5031.
    • Author

    • Torres-Larios A, Gurrola GB, Zamudio FZ, Possani LD.