• DRAMP ID

    • DRAMP03159
    • Peptide Name

    • WAP four-disulfide core domain protein 12 (mammals, animals)
    • Source

    • Pongo abelii (Sumatran orangutan)
    • Family

    • Not found
    • Gene

    • WFDC12
    • Sequence

    • VKKGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRP
    • Sequence Length

    • 67
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03159 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03159.
    • Formula

    • C314H504N92O100S8
    • Absent Amino Acids

    • MW
    • Common Amino Acids

    • CK
    • Mass

    • 7424.49
    • PI

    • 6.1
    • Basic Residues

    • 13
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +1
    • Boman Index

    • -151.23
    • Hydrophobicity

    • -0.691
    • Aliphatic Index

    • 58.06
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 30.15
    • Polar Residues

    • 20

DRAMP03159

DRAMP03159 chydropathy plot
    • Function

    • Antibacterial protein. Putative acid-stable proteinase inhibitor (By similarity).
    • Doamin

    • Contains 1 WAP domain
  • ·Literature 1
    • Title

    • Comparative sequence analyses reveal rapid and divergent evolutionary changes of the WFDC locus in the primate lineage.
    • Reference

    • Genome Res. 2007 Mar;17(3):276-286.
    • Author

    • Hurle B, Swanson W; NISC Comparative Sequencing Program, Green ED.