General Information

    • DRAMP ID

    • DRAMP03160

    • Peptide Name

    • WAP four-disulfide core domain protein 12 (mammals, animals)

    • Source

    • Callithrix jacchus (white-tufted-ear-marmoset)

    • Family

    • Not found

    • Gene

    • WFDC12

    • Sequence

    • VKVNIEKPGVCPADNIRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPCPEPGWEAKPPGVFSTRCPQK

    • Sequence Length

    • 88

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03160 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03160.

Physicochemical Information

    • Formula

    • C418H665N121O128S10

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • PC

    • Mass

    • 9754.21

    • PI

    • 6.84

    • Basic Residues

    • 15

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +2

    • Boman Index

    • -182.49

    • Hydrophobicity

    • -0.707

    • Aliphatic Index

    • 56.36

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7615

    • Absorbance 280nm

    • 87.53

    • Polar Residues

    • 26

DRAMP03160

DRAMP03160 chydropathy plot

Comments Information

    • Function

    • Antibacterial protein. Putative acid-stable proteinase inhibitor (By similarity).

    • Doamin

    • Contains 4 WAP domain

Literature Information

  • ·Literature 1

    • Title

    • Comparative sequence analyses reveal rapid and divergent evolutionary changes of the WFDC locus in the primate lineage.

    • Reference

    • Genome Res. 2007 Mar;17(3):276-286.

    • Author

    • Hurle B, Swanson W; NISC Comparative Sequencing Program, Green ED.