General Information

    • DRAMP ID

    • DRAMP03163

    • Peptide Name

    • R. prolixus defensin A (RprDefA; insect defensin; Insects, animals)

    • Source

    • Rhodnius prolixus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ATCDLFSFRSKWVTPNHAACAAHCLLRGNRGGRCKGTICHCRK

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli;
      • Gram-positive bacterium: Micrococcus luteus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03163 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03163.

Physicochemical Information

    • Formula

    • C200H322N70O53S6

    • Absent Amino Acids

    • EMQY

    • Common Amino Acids

    • C

    • Mass

    • 4747.55

    • PI

    • 9.69

    • Basic Residues

    • 11

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +10

    • Boman Index

    • -89.24

    • Hydrophobicity

    • -0.288

    • Aliphatic Index

    • 54.65

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 139.88

    • Polar Residues

    • 17

DRAMP03163

DRAMP03163 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of a novel insect defensin from Rhodnius prolixus, a vector of Chagas disease.

    • Reference

    • Insect Biochem Mol Biol. 2003 Apr;33(4):439-447.

    • Author

    • Lopez L, Morales G, Ursic R, Wolff M, Lowenberger C.