• DRAMP ID

    • DRAMP03165
    • Peptide Name

    • R. prolixus defensin C (RprDefC; insect defensin; Insects, animals)
    • Source

    • Rhodnius prolixus
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ATCDLFSFRSKWVTPNHAGCAAHCIFLGNRGGRCVGTVCHCRK
    • Sequence Length

    • 43
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal
    • Target Organism

      • Gram-negative bacterium: Escherichia coli;
      • Gram-positive bacterium: Micrococcus luteus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Serum or Protease Type

    • Not available
    • Stability Data

    • Not available
    • Assay

    • Not available
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03165 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03165.
    • Formula

    • C200H312N66O53S6
    • Absent Amino Acids

    • EMQY
    • Common Amino Acids

    • C
    • Mass

    • 4681.45
    • PI

    • 9.22
    • Basic Residues

    • 9
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +8
    • Boman Index

    • -63.5
    • Hydrophobicity

    • 0.028
    • Aliphatic Index

    • 56.74
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 139.88
    • Polar Residues

    • 18

DRAMP03165

DRAMP03165 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Isolation and characterization of a novel insect defensin from Rhodnius prolixus, a vector of Chagas disease.
    • Reference

    • Insect Biochem Mol Biol. 2003 Apr;33(4):439-447.
    • Author

    • Lopez L, Morales G, Ursic R, Wolff M, Lowenberger C.