General Information

    • DRAMP ID

    • DRAMP03170

    • Peptide Name

    • Antibacterial protein 1 homolog (Gram-positive bacteria)

    • Source

    • Staphylococcus haemolyticus (strain JCSC1435)

    • Family

    • Belongs to the staphylococcal hemolytic protein family

    • Gene

    • Not found

    • Sequence

    • MQKLAEAIAAAVQAGQDKDWGKMGTSIVGIVENGISVLGKIFGF

    • Sequence Length

    • 44

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Gonococci

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03170 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03170.

Physicochemical Information

    • Formula

    • C204H331N53O60S2

    • Absent Amino Acids

    • CHPRY

    • Common Amino Acids

    • G

    • Mass

    • 4550.31

    • PI

    • 5.97

    • Basic Residues

    • 4

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 20

    • Net Charge

    • 0

    • Boman Index

    • -4.86

    • Hydrophobicity

    • 0.398

    • Aliphatic Index

    • 102.05

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 127.91

    • Polar Residues

    • 11

DRAMP03170

DRAMP03170 chydropathy plot

Comments Information

    • Function

    • Has haemolytic activity and also inhibits the growth of gonococci (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Whole-genome sequencing of staphylococcus haemolyticus uncovers the extreme plasticity of its genome and the evolution of human-colonizing staphylococcal species.

    • Reference

    • J Bacteriol. 2005 Nov;187(21):7292-7308.

    • Author

    • Takeuchi F, Watanabe S, Baba T, Yuzawa H, Ito T, Morimoto Y, Kuroda M, Cui L, Takahashi M, Ankai A, Baba S, Fukui S, Lee JC, Hiramatsu K.