General Information

    • DRAMP ID

    • DRAMP03177

    • Peptide Name

    • Cecropin-P2 (CP2; nematodes, animals)

    • Source

    • Ascaris suum (Pig roundworm) (Ascaris lumbricoides)

    • Family

    • Belongs to the cecropin family

    • Gene

    • ASCEC-2

    • Sequence

    • SWLSKTYKKLENSAKKRISEGIAIAIQGGPR

    • Sequence Length

    • 31

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03177 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03177.

Physicochemical Information

    • Formula

    • C153H257N45O44

    • Absent Amino Acids

    • CDFHMV

    • Common Amino Acids

    • K

    • Mass

    • 3431

    • PI

    • 10.29

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -59.6

    • Hydrophobicity

    • -0.658

    • Aliphatic Index

    • 85.16

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 233

    • Polar Residues

    • 10

DRAMP03177

DRAMP03177 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against several Gram-positive and Gram-negative bacteria. Is weakly active against yeasts. Acts by a nonpore mechanism.

    • Induction

    • By bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • Cecropin P1 and novel nematode cecropins: a bacteria-inducible antimicrobial peptide family in the nematode Ascaris suum.

    • Reference

    • Biochem J. 2005 Aug 15;390(Pt 1):207-214.

    • Author

    • Pillai A, Ueno S, Zhang H, Lee JM, Kato Y.