General Information

    • DRAMP ID

    • DRAMP03180

    • Peptide Name

    • ASABF-alpha (ASABF; nematodes, animals)

    • Source

    • Ascaris suum (Pig roundworm) (Ascaris lumbricoides)

    • Family

    • Not found

    • Gene

    • asabf-alpha

    • Sequence

    • AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGRGGGEWPSVPMPKGRSSRGRRHS

    • Sequence Length

    • 75

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.10991847]Gram-negative bacteria: Escherichia coli JM109 (IC50=50 µg/ml), Proteus vulgaris ATCC 13315 (IC50=10 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus ATCC6538P (IC50=0.6 µg/ml), Bacillus subtilis ATCC6633 (IC50=1.2 µg/ml), Micrococcus luteus ATCC398 (IC50=0.8 µg/ml).

    • Hemolytic Activity

      • [Ref.10991847]4.5% hemolytic activity at 1000 μg/ml against human red blood cells

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03180 helical wheel diagram

    • PDB ID

    • 2D56 resolved by NMR.
  • 2D56-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03180.

Physicochemical Information

    • Formula

    • C325H532N114O100S10

    • Absent Amino Acids

    • Y

    • Common Amino Acids

    • G

    • Mass

    • 7957.1

    • PI

    • 9.49

    • Basic Residues

    • 15

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +10

    • Boman Index

    • -184.14

    • Hydrophobicity

    • -0.599

    • Aliphatic Index

    • 38.93

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 81.08

    • Polar Residues

    • 32

DRAMP03180

DRAMP03180 chydropathy plot

Comments Information

    • Slight hemolytic activity against human erythrocytes.

Literature Information

  • ·Literature 1

    • Title

    • ASABF, a novel cysteine-rich antibacterial peptide isolated from the nematode Ascaris suum. Purification, primary structure, and molecular cloning of cDNA.

    • Reference

    • J Biol Chem. 1996 Nov 29;271(48):30493-30498.

    • Author

    • Kato Y, Komatsu S.
  • ·Literature 2

    • Title

    • In vitro antimicrobial properties of recombinant ASABF, an antimicrobial peptide isolated from the nematode Ascaris suum.

    • Reference

    • Antimicrob Agents Chemother. 2000 Oct;44(10):2701-2715.

    • Author

    • Zhang H, Yoshida S, Aizawa T, Murakami R, Suzuki M, Koganezawa N, Matsuura A, Miyazawa M, Kawano K, Nitta K, Kato Y.