General Information

    • DRAMP ID

    • DRAMP03182

    • Peptide Name

    • Termicin (Termite defensin; Insects, animals)

    • Source

    • Pseudacanthotermes spiniger

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacteria: Bacillus megaterium, Micrococcus luteus, Streptococcus pyogenes(++).
      • Fungi: Fusarium culmorum, Fusarium oxysporum, Neurospora crassa, Nectria haematococca, Trichoderma viride(+); Candida albicans, Cryptococcus neoformans, Saccharomyces cerevisiae(+++).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03182 helical wheel diagram

    • PDB ID

    • 1MM0 resolved by NMR.
  • 1MM0-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03182.

Physicochemical Information

    • Formula

    • C181H271N57O49S6

    • Absent Amino Acids

    • ELMP

    • Common Amino Acids

    • C

    • Mass

    • 4221.86

    • PI

    • 8.96

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -77.21

    • Hydrophobicity

    • -0.153

    • Aliphatic Index

    • 38.06

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 210.43

    • Polar Residues

    • 13

DRAMP03182

DRAMP03182 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity. Constitutive expression of a cysteine-rich antifungal and a linear antibacterial peptide in a termite insect.

    • Reference

    • J Biol Chem. 2001 Feb 9;276(6):4085-4092.

    • Author

    • Lamberty M, Zachary D, Lanot R, Bordereau C, Robert A, Hoffmann JA, Bulet P.
  • ·Literature 2

    • Title

    • Solution structure of termicin, an antimicrobial peptide from the termite Pseudacanthotermes spiniger.

    • Reference

    • Protein Sci. 2003 Mar;12(3):438-446.

    • Author

    • Da Silva P, Jouvensal L, Lamberty M, Bulet P, Caille A, Vovelle F.