General Information

    • DRAMP ID

    • DRAMP03184

    • Peptide Name

    • Naegleriapore B

    • Source

    • Naegleria fowleri (Brain eating amoeba)

    • Family

    • Not found

    • Gene

    • NP-B

    • Sequence

    • SVIGCEICEWLVATAEGFVNKTKPQIEQELLQICAKLGPYEQICDQLVLMELPDIIDQIIAKEPPAIVCSQVKICNG

    • Sequence Length

    • 77

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiprotozoal, Cytotoxic

    • Target Organism

      • Gram-negative bacterium: Escherichia coli K-12 D31;
      • Gram-positive bacterium: Bacillus subtilis strain 60015.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix

    • Structure Description

    • It is characterized by a structure of amphipathic α-helices and an invariant framework of cysteine residues involved in disulfide bonds.

    • Helical Wheel Diagram

    • DRAMP03184 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03184.

Physicochemical Information

    • Formula

    • C377H616N92O114S7

    • Absent Amino Acids

    • HR

    • Common Amino Acids

    • I

    • Mass

    • 8486.01

    • PI

    • 4.29

    • Basic Residues

    • 5

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 31

    • Net Charge

    • -6

    • Boman Index

    • -31.58

    • Hydrophobicity

    • 0.334

    • Aliphatic Index

    • 120.26

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 96.91

    • Polar Residues

    • 17

DRAMP03184

DRAMP03184 chydropathy plot

Comments Information

    • Function

    • Posesses antibacterial, cytotoxicity and pore-forming activity. Naegleriapore B does not exert any antibacterial activity in concentration up to 10 µm against the bacteria tested. The specific pore-forming activities of naegleriapore A and B are 3.1±1.7 units pmol−1 and 3.7±1.3 units pmol−1, respectively.

Literature Information

  • ·Literature 1

    • Title

    • Pore-forming polypeptides of the pathogenic protozoon Naegleria fowleri.

    • Reference

    • J Biol Chem. 2002 Jun 21;277(25):22353-22360.

    • Author

    • Herbst R, Ott C, Jacobs T, Marti T, Marciano-Cabral F, Leippe M.