General Information

    • DRAMP ID

    • DRAMP03187

    • Peptide Name

    • Beta defensin 1(BD-1; mammals, animals)

    • Source

    • Chinchilla lanigera (Long-tailed chinchilla)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB1

    • Sequence

    • QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacterium: Moraxella catarrhalis (MIC=5 µg/ml);
      • Gram-positive bacterium: Streptococcus pneumoniae (MIC=5 µg/ml).
      • Fungi: Candida albicans (MIC=12.5-20 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are three disulfide bonds.

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03187 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03187.

Physicochemical Information

    • Formula

    • C169H292N64O45S6

    • Absent Amino Acids

    • DHMNW

    • Common Amino Acids

    • R

    • Mass

    • 4132.94

    • PI

    • 10.35

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +9

    • Boman Index

    • -116.15

    • Hydrophobicity

    • -0.531

    • Aliphatic Index

    • 54.17

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 53.29

    • Polar Residues

    • 14

DRAMP03187

DRAMP03187 chydropathy plot

Comments Information

    • Function

    • Has antibacterial and antifungal activity. May have a role in maintaining sterility in the middle ear.

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of a mucosal antimicrobial peptide expressed by the chinchilla (Chinchilla lanigera) airway.

    • Reference

    • J Biol Chem. 2004 May 7;279(19):20250-20256.

    • Author

    • Harris RH, Wilk D, Bevins CL, Munson RS Jr, Bakaletz LO.