General Information

    • DRAMP ID

    • DRAMP03198

    • Peptide Name

    • Alpha-defensin PhD-4 (primates, mammals, animals)

    • Source

    • Papio hamadryas (Hamadryas baboon)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Not found

    • Sequence

    • ACYCRIPACFAGERRYGTCFYLGRVWAFCC

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • In low salt conditions: Gram-negative bacterium: E. coli ML35p (MIC=2.4 µM),;
      • Gram-positive bacteria: Listeria monocytogenes EGD (MIC=2.2 µM), methicillin-resistant S. aureus ATCC 33591 (MIC=3.5 µM).
      • Fungi: Candida albicans 820 (MIC=3.9 µM).
      • At high physiological salt concentrations: E. coli ML35p (MIC=7.1 µM), L. monocytogenes EGD (MIC=1.8 µM), S. aureus ATCC 33591 (MIC>50 µM), Candida albicans 820 (MIC>50 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization(Cys2 and Cys30).

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys2 and Cys30; Cys4 and Cys19; Cys9 and Cys29.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03198 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03198.

Physicochemical Information

    • Formula

    • C156H225N43O37S6

    • Absent Amino Acids

    • DHKMNQS

    • Common Amino Acids

    • C

    • Mass

    • 3487.13

    • PI

    • 8.68

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -26.59

    • Hydrophobicity

    • 0.443

    • Aliphatic Index

    • 49

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 356.72

    • Polar Residues

    • 13

DRAMP03198

DRAMP03198 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity in low salt conditions, and the antimicrobial activity decreases significantly at high physiological salt concentrations.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • De novo sequencing of two new cyclic theta-defensins from baboon (Papio hamadryas) leukocytes by matrix-assisted laser desorption/ionization mass spectrometry.

    • Reference

    • Rapid Commun Mass Spectrom. 2010 Mar 15;24(5):599-604.

    • Author

    • Stegemann C, Tsvetkova EV, Aleshina GM, Lehrer RI, Kokryakov VN, Hoffmann R.