General Information

    • DRAMP ID

    • DRAMP03216

    • Peptide Name

    • Oxyopinin-4a (Oxt-4a; spiders, Arthropods, animals)

    • Source

    • Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.21933345]Gram-positive bacteria: S. aureus (MIC=10 µM) and Bacillus subtilis (MIC=0.5 µM);
      • Gram-negative bacteria: P. fluorescens (MIC=1 µM) and E. coli (MIC=0.5 µM).

    • Hemolytic Activity

      • [Ref.21933345] EC50=7 μM against human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Cell membrane (Probable)

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys4 and Cys10.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03216 helical wheel diagram

    • PDB ID

    • 2L3I resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP03216.

Physicochemical Information

    • Formula

    • C164H274N52O34S3

    • Absent Amino Acids

    • DENTY

    • Common Amino Acids

    • K

    • Mass

    • 3614.49

    • PI

    • 11.59

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +10

    • Boman Index

    • -58.36

    • Hydrophobicity

    • -0.32

    • Aliphatic Index

    • 84.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 193.97

    • Polar Residues

    • 4

DRAMP03216

DRAMP03216 chydropathy plot

Comments Information

    • Function

    • Disrupts cell membranes through the formation of pores Probable. Has antibacterial activity. Has hemolytic activity against human erythrocytes.

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains one disulfide bond 4-10.

Literature Information

  • ·Literature 1

    • Title

    • Novel lynx spider toxin shares common molecular architecture with defense peptides from frog skin.

    • Reference

    • FEBS J. 2011 Nov;278(22):4382-4393.

    • Author

    • Dubovskii PV, Vassilevski AA, Samsonova OV, Egorova NS, Kozlov SA, Feofanov AV, Arseniev AS, Grishin EV.