General Information

    • DRAMP ID

    • DRAMP03223

    • Peptide Name

    • M-ctenitoxin-Cs1b (M-CNTX-Cs1b; Cupiennin-1b; spiders, Arthropods, animals)

    • Source

    • Cupiennius salei (Wandering spider)

    • Family

    • Belongs to the cupiennin family

    • Gene

    • Not found

    • Sequence

    • GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQME

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • [Ref.11792701]Not determined

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03223 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03223.

Physicochemical Information

    • Formula

    • C175H287N47O45S

    • Absent Amino Acids

    • CDHPRW

    • Common Amino Acids

    • K

    • Mass

    • 3801.55

    • PI

    • 10.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +7

    • Boman Index

    • -30.96

    • Hydrophobicity

    • -0.266

    • Aliphatic Index

    • 70

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 43.82

    • Polar Residues

    • 7

DRAMP03223

DRAMP03223 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity. Has insecticidal activity. Probably acts by disturbing membrane Function

Literature Information

  • ·Literature 1

    • Title

    • Cupiennin 1, a new family of highly basic antimicrobial peptides in the venom of the spider Cupiennius salei (Ctenidae).

    • Reference

    • J Biol Chem. 2002 Mar 29;277(13):11208-11216.

    • Author

    • Kuhn-Nentwig L, Muller J, Schaller J, Walz A, Dathe M, Nentwig W.