General Information

    • DRAMP ID

    • DRAMP03225

    • Peptide Name

    • M-ctenitoxin-Cs1d (M-CNTX-Cs1d; Cupiennin-1d; spiders, Arthropods, animals)

    • Source

    • Cupiennius salei (Wandering spider)

    • Family

    • Belongs to the cupiennin family

    • Gene

    • Not found

    • Sequence

    • GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHME

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.11792701]Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=0.08-0.16 µM), Pseudomonas aeruginosa ATCC 27853 (MIC=0.16-0.31 µM);
      • Gram-positive bacteria: Staphylococcus aureus ATCC 29213 (MIC=0.63-1.25 µM), Enterococcus faecalis ATCC 29212 (MIC=1.25-2.50 µM).

    • Hemolytic Activity

      • [Ref.11792701]Not determined

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03225 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03225.

Physicochemical Information

    • Formula

    • C175H284N48O44S

    • Absent Amino Acids

    • CDIPRW

    • Common Amino Acids

    • K

    • Mass

    • 3796.54

    • PI

    • 10.3

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +8

    • Boman Index

    • -30.96

    • Hydrophobicity

    • -0.266

    • Aliphatic Index

    • 67.14

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 43.82

    • Polar Residues

    • 7

DRAMP03225

DRAMP03225 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity. Has insecticidal activity. Probably acts by disturbing membrane Function

    • Tissue specificity

    • Expressed by the venom gland.

    • Toxic dose

    • LD50 is 6.4 pmol/mg on Drosophila.

Literature Information

  • ·Literature 1

    • Title

    • Cupiennin 1, a new family of highly basic antimicrobial peptides in the venom of the spider Cupiennius salei (Ctenidae).

    • Reference

    • J Biol Chem. 2002 Mar 29;277(13):11208-11216.

    • Author

    • Kuhn-Nentwig L, Muller J, Schaller J, Walz A, Dathe M, Nentwig W.
  • ·Literature 2

    • Title

    • Characterisation of antibacterial activity of peptides isolated from the venom of the spider Cupiennius salei (Araneae: Ctenidae).

    • Reference

    • Toxicon. 2000 Mar;38(3):373-380.

    • Author

    • Haeberli S, Kuhn-Nentwig L, Schaller J, Nentwig W.