General Information

    • DRAMP ID

    • DRAMP03234

    • Peptide Name

    • M-zodatoxin-Lt6a (M-ZDTX-Lt6a; Latarcin 6a, Ltc-6a; spiders, Arthropods, animals)

    • Source

    • Lachesana tarabaevi (Spider)

    • Family

    • Belongs to the latarcin family

    • Gene

    • Not found

    • Sequence

    • QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL

    • Sequence Length

    • 33

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03234 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03234.

Physicochemical Information

    • Formula

    • C182H285N51O48S3

    • Absent Amino Acids

    • CEHV

    • Common Amino Acids

    • K

    • Mass

    • 4051.76

    • PI

    • 10.29

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +5

    • Boman Index

    • -81.51

    • Hydrophobicity

    • -1.003

    • Aliphatic Index

    • 41.52

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 218.44

    • Polar Residues

    • 7

DRAMP03234

DRAMP03234 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Latarcins, antimicrobial and cytolytic peptides from the venom of the spider Lachesana tarabaevi (Zodariidae) that exemplify biomolecular diversity.

    • Reference

    • J Biol Chem. 2006 Jul 28;281(30):20983-20992.

    • Author

    • Kozlov SA, Vassilevski AA, Feofanov AV, Surovoy AY, Karpunin DV, Grishin EV.