• DRAMP ID

    • DRAMP03236
    • Peptide Name

    • M-zodatoxin-Lt8a (M-ZDTX-Lt8a; Cytoinsectotoxin-1a, CIT-1a; spiders, Arthropods, animals)
    • Source

    • Lachesana tarabaevi (Spider)
    • Family

    • Belongs to the cytoinsectotoxin family
    • Gene

    • cit 1-1
    • Sequence

    • GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
    • Sequence Length

    • 69
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Insecticidal
    • Target Organism

      • [Ref.18215128]Gram-positive bacteria: Arthrobacter globiformis VKM Ac-1112 (MIC=0.5 µM), Bacillus subtilis VKM B-501 (MIC=0.9 µM), Micrococcus luteus (MIC>30 µM), Staphylococcus aureus (MIC>30 µM);
      • Gram-negative bacteria: Escherichia coli C600 (MIC=0.5 µM), E. coli DH5alpha (MIC=0.9 µM), E. coli MH1 (MIC=0.5 µM), Pseudomonas aeruginosa PAO1 (MIC=1.9 µM), Pseudomonas fluorescens VKM B-894 (MIC=3.8 µM).
    • Hemolytic Activity

      • [Ref.18215128]EC50=6 μM against human erythrocytes
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03236 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03236.
    • Formula

    • C363H612N96O93S3
    • Absent Amino Acids

    • CHP
    • Common Amino Acids

    • K
    • Mass

    • 7905.62
    • PI

    • 10.16
    • Basic Residues

    • 20
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 24
    • Net Charge

    • +14
    • Boman Index

    • -102.55
    • Hydrophobicity

    • -0.604
    • Aliphatic Index

    • 84.93
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 9970
    • Absorbance 280nm

    • 146.62
    • Polar Residues

    • 13

DRAMP03236

DRAMP03236 chydropathy plot
    • Function

    • Insecticidal, cytolytic and antimicrobial peptide. Has insecticidal activity against the flesh fly S. carnaria, and against the cockroach N. cinerea. CIT 1a Has hemolytic activity against human erythrocytes, and cytolytic activity against insect Sf9 cells in the same concentration range. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.
    • Tissue specificity

    • Expressed by the venom gland.
    • Toxic dose

    • LD50 is 5 µg/g for adult and 20 µg/g for larvae of flesh fly S. carnaria. LD50 is 500 µg/g for cockroach N. cinerea.
  • ·Literature 1
    • Title

    • Cyto-insectotoxins, a novel class of cytolytic and insecticidal peptides from spider venom.
    • Reference

    • Biochem J. 2008 May 1;411(3):687-696.
    • Author

    • Vassilevski A.A, Kozlov S.A, Samsonova O.V, Egorova N.S, Karpunin D.V, Pluzhnikov K.A, Feofanov A.V, Grishin E.V.