General Information

    • DRAMP ID

    • DRAMP03242

    • Peptide Name

    • M-zodatoxin-Lt8g (M-ZDTX-Lt8g; Cytoinsectotoxin-1g, CIT-1g; spiders, Arthropods, animals)

    • Source

    • Lachesana tarabaevi (Spider)

    • Family

    • Belongs to the cytoinsectotoxin family

    • Gene

    • cit 1-8

    • Sequence

    • GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYVLKHYGKKALQKASEKL

    • Sequence Length

    • 69

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-, Insecticidal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03242 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03242.

Physicochemical Information

    • Formula

    • C359H608N98O92S3

    • Absent Amino Acids

    • CP

    • Common Amino Acids

    • K

    • Mass

    • 7865.56

    • PI

    • 10.21

    • Basic Residues

    • 21

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +15

    • Boman Index

    • -107.95

    • Hydrophobicity

    • -0.626

    • Aliphatic Index

    • 83.48

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 124.71

    • Polar Residues

    • 12

DRAMP03242

DRAMP03242 chydropathy plot

Comments Information

    • Function

    • Has insecticidal activity against the flesh fly S. carnaria. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.

    • Tissue specificity

    • Expressed by the venom gland.

Literature Information

  • ·Literature 1

    • Title

    • Cyto-insectotoxins, a novel class of cytolytic and insecticidal peptides from spider venom.

    • Reference

    • Biochem J. 2008 May 1;411(3):687-696.

    • Author

    • Vassilevski A.A, Kozlov S.A, Samsonova O.V, Egorova N.S, Karpunin D.V, Pluzhnikov K.A, Feofanov A.V, Grishin E.V.