• DRAMP ID

    • DRAMP03242
    • Peptide Name

    • M-zodatoxin-Lt8g (M-ZDTX-Lt8g; Cytoinsectotoxin-1g, CIT-1g; spiders, Arthropods, animals)
    • Source

    • Lachesana tarabaevi (Spider)
    • Family

    • Belongs to the cytoinsectotoxin family
    • Gene

    • cit 1-8
    • Sequence

    • GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYVLKHYGKKALQKASEKL
    • Sequence Length

    • 69
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-, Insecticidal
    • Target Organism

      • Gram-negative bacterium: Escherichia coli.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Serum or Protease Type

    • Not available
    • Stability Data

    • Not available
    • Assay

    • Not available
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03242 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03242.
    • Formula

    • C359H608N98O92S3
    • Absent Amino Acids

    • CP
    • Common Amino Acids

    • K
    • Mass

    • 7865.56
    • PI

    • 10.21
    • Basic Residues

    • 21
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 24
    • Net Charge

    • +15
    • Boman Index

    • -107.95
    • Hydrophobicity

    • -0.626
    • Aliphatic Index

    • 83.48
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 124.71
    • Polar Residues

    • 12

DRAMP03242

DRAMP03242 chydropathy plot
    • Function

    • Has insecticidal activity against the flesh fly S. carnaria. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Cyto-insectotoxins, a novel class of cytolytic and insecticidal peptides from spider venom.
    • Reference

    • Biochem J. 2008 May 1;411(3):687-696.
    • Author

    • Vassilevski A.A, Kozlov S.A, Samsonova O.V, Egorova N.S, Karpunin D.V, Pluzhnikov K.A, Feofanov A.V, Grishin E.V.