• DRAMP ID

    • DRAMP03249
    • Peptide Name

    • M-zodatoxin-Lt8o (M-ZDTX-Lt8o; Cytoinsectotoxin 1-14; spiders, Arthropods, animals)
    • Source

    • Lachesana tarabaevi (Spider)
    • Family

    • Belongs to the cytoinsectotoxin family
    • Gene

    • cit 1-14
    • Sequence

    • GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKLFKKRPKNCDQ
    • Sequence Length

    • 71
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03249 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03249.
    • Formula

    • C380H635N103O95S4
    • Absent Amino Acids

    • H
    • Common Amino Acids

    • K
    • Mass

    • 8295.1
    • PI

    • 10.19
    • Basic Residues

    • 22
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 22
    • Net Charge

    • +16
    • Boman Index

    • -132.45
    • Hydrophobicity

    • -0.796
    • Aliphatic Index

    • 74.23
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 9970
    • Absorbance 280nm

    • 142.43
    • Polar Residues

    • 14

DRAMP03249

DRAMP03249 chydropathy plot
    • Function

    • Insecticidal, cytolytic and antimicrobial peptide. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis.
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Cyto-insectotoxins, a novel class of cytolytic and insecticidal peptides from spider venom.
    • Reference

    • Biochem J. 2008 May 1;411(3):687-696.
    • Author

    • Vassilevski A.A, Kozlov S.A, Samsonova O.V, Egorova N.S, Karpunin D.V, Pluzhnikov K.A, Feofanov A.V, Grishin E.V.