• DRAMP ID

    • DRAMP03267
    • Peptide Name

    • U15-lycotoxin-Ls1d (Toxin-like structure LSTX-N8; spiders, Arthropods, animals)
    • Source

    • Lycosa singoriensis (Wolf spider) (Aranea singoriensis)
    • Family

    • Spider wap-1 family (Contains 1 WAP domain)
    • Gene

    • Not found
    • Sequence

    • DQYCPKSSITACKKMNIRNDCCKDDDCTGGSWCCATPCGNFCKYPTDRPGGKRAAGGKSCKTGYVY
    • Sequence Length

    • 66
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03267 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03267.
    • Formula

    • C295H462N88O96S11
    • Absent Amino Acids

    • EHL
    • Common Amino Acids

    • C
    • Mass

    • 7130.11
    • PI

    • 8.72
    • Basic Residues

    • 11
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +5
    • Boman Index

    • -144.85
    • Hydrophobicity

    • -0.788
    • Aliphatic Index

    • 22.27
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12085
    • Absorbance 280nm

    • 185.92
    • Polar Residues

    • 34

DRAMP03267

DRAMP03267 chydropathy plot
    • Function

    • Has antibacterial activity (By similarity).
    • Tissue specificity

    • Expressed by the venom gland.
    • PTM

    • Contains four disulfide bonds (Probable).
  • ·Literature 1
    • Title

    • Transcriptome analysis of the venom glands of the Chinese wolf spider Lycosa singoriensis.
    • Reference

    • Zoology (Jena). 2010 Jan;113(1):10-18.
    • Author

    • hang Y, Chen J, Tang X, Wang F, Jiang L, Xiong X, Wang M, Rong M, Liu Z, Liang S.