General Information

    • DRAMP ID

    • DRAMP03277

    • Peptide Name

    • U15-lycotoxin-Ls1h (Toxin-like structure LSTX-N18; spiders, Arthropods, animals)

    • Source

    • Lycosa singoriensis (Wolf spider) (Aranea singoriensis)

    • Family

    • Spider wap-1 family (Contains 1 WAP domain)

    • Gene

    • Not found

    • Sequence

    • DQYCPKSSITACKKMNTRNDCCKDDDCTGGSWCCATPCGNFCKYPTDRPGGKRAAGGKSCKTGYVYY

    • Sequence Length

    • 67

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03277 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03277.

Physicochemical Information

    • Formula

    • C302H467N89O99S11

    • Absent Amino Acids

    • EHL

    • Common Amino Acids

    • C

    • Mass

    • 7281.23

    • PI

    • 8.71

    • Basic Residues

    • 11

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +5

    • Boman Index

    • -152.48

    • Hydrophobicity

    • -0.873

    • Aliphatic Index

    • 16.12

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13575

    • Absorbance 280nm

    • 205.68

    • Polar Residues

    • 36

DRAMP03277

DRAMP03277 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (By similarity).

    • Tissue specificity

    • Expressed by the venom gland.

    • PTM

    • Contains four disulfide bonds (Probable).

Literature Information

  • ·Literature 1

    • Title

    • Transcriptome analysis of the venom glands of the Chinese wolf spider Lycosa singoriensis.

    • Reference

    • Zoology (Jena). 2010 Jan;113(1):10-18.

    • Author

    • hang Y, Chen J, Tang X, Wang F, Jiang L, Xiong X, Wang M, Rong M, Liu Z, Liang S.