• DRAMP ID

    • DRAMP03280
    • Peptide Name

    • AcAMP (A. clavatus antimicrobial peptide)
    • Source

    • Aspergillus clavatus ES1
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYC
    • Sequence Length

    • 51
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal
    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus (MIC=20 µg/ml), Bacillus cereus (MIC=10 µg/ml), Micrococcus luteus (MIC=10 µg/ml), Enterococcus faecalis (MIC=50 µg/ml);
      • Gram-negative bacteria: Escherichia coli (MIC=30 µg/ml), Pseudomonas aeruginosa (MIC=50 µg/ml).
      • Fungi: Aspergillus niger, Fusarium solani, Fusarium oxysporum.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization(Cys33 and Cys51).
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys7 and Cys26,Cys14 and Cys40,Cys28 and Cys49,Cys33 and Cys51.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03280 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03280.
    • Formula

    • C250H393N67O74S8
    • Absent Amino Acids

    • HLMW
    • Common Amino Acids

    • K
    • Mass

    • 5777.76
    • PI

    • 9.06
    • Basic Residues

    • 12
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +7
    • Boman Index

    • -100.48
    • Hydrophobicity

    • -0.755
    • Aliphatic Index

    • 34.51
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 9440
    • Absorbance 280nm

    • 188.8
    • Polar Residues

    • 23

DRAMP03280

DRAMP03280 chydropathy plot
    • This basic, Cys-rich antifungal peptide is also active against bacteria. AcAMP was sensitive to proteolytic enzymes, stable between pH 5.0 and 10.0, and heat resistant (15 min at 100 degrees C).

  • ·Literature 1
    • Title

    • A highly thermostable antimicrobial peptide from Aspergillus clavatus ES1: biochemical and molecular characterization.
    • Reference

    • J Ind Microbiol Biotechnol. 2010 Aug;37(8):805-813.
    • Author

    • Hajji M, Jellouli K, Hmidet N, Balti R, Sellami-Kamoun A, Nasri M.