General Information

    • DRAMP ID

    • DRAMP03282

    • Peptide Name

    • Turkey Heterophil Peptide 1 (Antimicrobial peptide THP1; Birds, animals)

    • Source

    • Meleagris gallopavo (Common turkey)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 25922;
      • Gram-positive bacterium: Staphylococcus aureus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03282 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03282.

Physicochemical Information

    • Formula

    • C166H276N52O45S6

    • Absent Amino Acids

    • DHMWY

    • Common Amino Acids

    • C

    • Mass

    • 3912.7

    • PI

    • 9.43

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -61.65

    • Hydrophobicity

    • 0.077

    • Aliphatic Index

    • 64

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 11.03

    • Polar Residues

    • 15

DRAMP03282

DRAMP03282 chydropathy plot

Comments Information

    • PTM

    • Contains two disulfide bonds

Literature Information

  • ·Literature 1

    • Title

    • Isolation of antimicrobial peptides from avian heterophils.

    • Reference

    • J Leukoc Biol. 1994 Nov;56(5):661-665.

    • Author

    • Evans EW, Beach GG, Wunderlich J, Harmon BG.