• DRAMP ID

    • DRAMP03282
    • Peptide Name

    • Turkey Heterophil Peptide 1 (Antimicrobial peptide THP1; Birds, animals)
    • Source

    • Meleagris gallopavo (Common turkey)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Not found
    • Sequence

    • GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC
    • Sequence Length

    • 35
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 25922;
      • Gram-positive bacterium: Staphylococcus aureus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03282 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03282.
    • Formula

    • C166H276N52O45S6
    • Absent Amino Acids

    • DHMWY
    • Common Amino Acids

    • C
    • Mass

    • 3912.7
    • PI

    • 9.43
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +6
    • Boman Index

    • -61.65
    • Hydrophobicity

    • 0.077
    • Aliphatic Index

    • 64
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 11.03
    • Polar Residues

    • 15

DRAMP03282

DRAMP03282 chydropathy plot
    • PTM

    • Contains two disulfide bonds
  • ·Literature 1
    • Title

    • Isolation of antimicrobial peptides from avian heterophils.
    • Reference

    • J Leukoc Biol. 1994 Nov;56(5):661-665.
    • Author

    • Evans EW, Beach GG, Wunderlich J, Harmon BG.