• DRAMP ID

    • DRAMP03283
    • Peptide Name

    • Turkey Heterophil Peptide 2 (Antimicrobial peptide THP2, THP2; Birds, animals)
    • Source

    • Meleagris gallopavo (Common turkey)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Not found
    • Sequence

    • LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
    • Sequence Length

    • 36
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03283 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03283.
    • Formula

    • C185H274N54O43S6
    • Absent Amino Acids

    • EMNQY
    • Common Amino Acids

    • C
    • Mass

    • 4134.91
    • PI

    • 9.18
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +7
    • Boman Index

    • -43.59
    • Hydrophobicity

    • -0.014
    • Aliphatic Index

    • 43.33
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 11375
    • Absorbance 280nm

    • 325
    • Polar Residues

    • 14

DRAMP03283

DRAMP03283 chydropathy plot
    • Tissue specificity

    • Expressed in circulating heterophil granulocytes and bone marrow (at protein level).
    • PTM

    • Contains three disulfide bonds 3-29; 8-23; 13-30.
  • ·Literature 1
    • Title

    • Isolation of antimicrobial peptides from avian heterophils.
    • Reference

    • J Leukoc Biol. 1994 Nov;56(5):661-665.
    • Author

    • Evans EW, Beach GG, Wunderlich J, Harmon BG.
  • ·Literature 2
    • Title

    • Direct screening identifies mature beta-defensin 2 in avian heterophils.
    • Reference

    • Poult Sci. 2009 Feb;88(2):372-379.
    • Author

    • Kannan L, Rath NC, Liyanage R, Lay JO Jr.