General Information

    • DRAMP ID

    • DRAMP03283

    • Peptide Name

    • Turkey Heterophil Peptide 2 (Antimicrobial peptide THP2, THP2; Birds, animals)

    • Source

    • Meleagris gallopavo (Common turkey)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03283 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03283.

Physicochemical Information

    • Formula

    • C185H274N54O43S6

    • Absent Amino Acids

    • EMNQY

    • Common Amino Acids

    • C

    • Mass

    • 4134.91

    • PI

    • 9.18

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +7

    • Boman Index

    • -43.59

    • Hydrophobicity

    • -0.014

    • Aliphatic Index

    • 43.33

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 11375

    • Absorbance 280nm

    • 325

    • Polar Residues

    • 14

DRAMP03283

DRAMP03283 chydropathy plot

Comments Information

    • Tissue specificity

    • Expressed in circulating heterophil granulocytes and bone marrow (at protein level).

    • PTM

    • Contains three disulfide bonds 3-29; 8-23; 13-30.

Literature Information

  • ·Literature 1

    • Title

    • Isolation of antimicrobial peptides from avian heterophils.

    • Reference

    • J Leukoc Biol. 1994 Nov;56(5):661-665.

    • Author

    • Evans EW, Beach GG, Wunderlich J, Harmon BG.
  • ·Literature 2

    • Title

    • Direct screening identifies mature beta-defensin 2 in avian heterophils.

    • Reference

    • Poult Sci. 2009 Feb;88(2):372-379.

    • Author

    • Kannan L, Rath NC, Liyanage R, Lay JO Jr.