• • DRAMP ID

  • DRAMP03285

• • Peptide Name

  • Ostricacin-1 (Beta-defensin 2; Birds, animals)

• • Source

  • Struthio camelus (Ostrich)

• • Family

  • Belongs to the beta-defensin family

• • Gene

  • Not found

• • Sequence

  • LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV

• • Sequence Length

  • 36

• • UniProt Entry

  • P85113

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-positive bacteria: Staphylococcus aureus 1056-MRSA (MIC=1.25 µg/ml), S. aureus NCTC 4163 (MIC=6.7 µg/ml);
    • Gram-negative bacteria: Escherichia coli O157:H7 (MIC=0.96 µg/ml), E. coli 0111 (MIC=6.7 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bonds between Cys3 and Cys29,Cys8 and Cys23,Cys13 and Cys30.

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP03285_predicted_structure.pdb to download.

DRAMP03285

• • PTM

  • Contains three disulfide bonds 3-29; 8-23; 13-30.

• ·Literature 1

• • Title

  • Purification and characterization of the antimicrobial peptide, ostricacin.

• • Pubmed ID

  • 16459058

• • Reference

  • Biotechnol Lett 2001; 23: 207-210.

• • Author

  • Yu, PL, Choudhury SD, Ahrens K.