• • DRAMP ID

  • DRAMP03286

• • Peptide Name

  • Ostricacin-2 (Beta-defensin 1; Birds, animals)

• • Source

  • Struthio camelus (Ostrich)

• • Family

  • Belongs to the beta-defensin family

• • Gene

  • Not found

• • Sequence

  • APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW

• • Sequence Length

  • 41

• • UniProt Entry

  • P85114

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacterium: Staphylococcus aureus 1056-MRSA (MIC=1.25 µg/ml);
    • Gram-negative bacterium: Escherichia coli O157:H7 (MIC=0.96 µg/ml);
    • Yeast: Candida albicans 3153A (MIC=6.2 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bonds between Cys8 and Cys36,Cys15 and Cys30,Cys20 and Cys37.

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03286.

DRAMP03286

• • PTM

  • Contains three disulfide bonds 8-36; 15-30; 20-37.

• ·Literature 1

• • Title

  • Identification of three novel ostricacins: an update on the phylogenetic perspective of beta-defensins.

• • Pubmed ID

  • 16459058

• • Reference

  • Int J Antimicrob Agents. 2006 Mar;27(3):229-235.

• • Author

  • Sugiarto H, Yu PL.