General Information

    • DRAMP ID

    • DRAMP03289

    • Peptide Name

    • Apl-AvBD16 (Beta defensins; Ducks, birds, animals)

    • Source

    • Anas platyrhynchos (Peking duck)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03289 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03289.

Physicochemical Information

    • Formula

    • C242H372N78O60S6

    • Absent Amino Acids

    • DKMY

    • Common Amino Acids

    • G

    • Mass

    • 5526.46

    • PI

    • 9.3

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +8

    • Boman Index

    • -60.42

    • Hydrophobicity

    • 0.242

    • Aliphatic Index

    • 72.2

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 119.9

    • Polar Residues

    • 19

DRAMP03289

DRAMP03289 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S.

    • Reference

    • PLoS One. 2012;7(10):e47743.

    • Author

    • Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S.