General Information

    • DRAMP ID

    • DRAMP03290

    • Peptide Name

    • Anas platyrhynchos avian beta-defensin 2 (Apl_AvBD2; Ducks, birds, animals)

    • Source

    • Anas platyrhynchos (Domestic duck)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • BD2

    • Sequence

    • MRILYLLFSVLFLVLQVSPGLSLPQRDMFLCRIGSCHFGRCPIHLVRVGSCFGFRSCCKSPWDV

    • Sequence Length

    • 64

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Micrococcus luteusNCIM 2871 (MBC=3.7 µM), Escherichia coli NCIM 2685, Riemerella anatipestifer (MBC=2.2 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03290 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03290.

Physicochemical Information

    • Formula

    • C333H522N90O79S8

    • Absent Amino Acids

    • AENT

    • Common Amino Acids

    • L

    • Mass

    • 7306.84

    • PI

    • 9.21

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 26

    • Net Charge

    • +7

    • Boman Index

    • -31.36

    • Hydrophobicity

    • 0.7

    • Aliphatic Index

    • 106.41

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 116.9

    • Polar Residues

    • 19

DRAMP03290

DRAMP03290 chydropathy plot

Comments Information

    • The widespread tissue distribution and the potent bactericidal and chemotactic activity make Apl_AvBD2 an important molecule in the innate immune response in ducks. It may play a vital role in the immune response of these birds against bacterial and viral pathogens.

Literature Information

  • ·Literature 1

    • Title

    • Discovery of Anas platyrhynchos avian beta-defensin 2 (Apl_AvBD2) with antibacterial and chemotactic functions

    • Reference

    • Mol Immunol. 2009 Jun;46(10):2029-2038.

    • Author

    • Soman SS, Arathy DS, Sreekumar E.