General Information

    • DRAMP ID

    • DRAMP03291

    • Peptide Name

    • Beta defensin-6-like antimicrobial peptide (Ducks, birds, animals; Predicted)

    • Source

    • Anas platyrhynchos (Domestic duck) (Anas boschas)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK

    • Sequence Length

    • 36

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03291 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03291.

Physicochemical Information

    • Formula

    • C152H257N51O48S6

    • Absent Amino Acids

    • EMNWY

    • Common Amino Acids

    • C

    • Mass

    • 3759.39

    • PI

    • 8.94

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +5

    • Boman Index

    • -65.1

    • Hydrophobicity

    • -0.083

    • Aliphatic Index

    • 56.94

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 10.71

    • Polar Residues

    • 16

DRAMP03291

DRAMP03291 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Two novel duck antibacterial peptides, avian beta-defensins 9 and 10, with antimicrobial activity.

    • Reference

    • J Microbiol Biotechnol. 2009 Nov;19(11):1447-1455.

    • Author

    • Ma D, Liao W, Wang R, Han Z, Liu S.