General Information

    • DRAMP ID

    • DRAMP03295

    • Peptide Name

    • Defensin-B4 (DefB4; OaDefB4; mammals, animals)

    • Source

    • Ornithorhynchus anatinus (Duckbill platypus)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • CKGKLGYCRSKCQSKQVELGKCSTKAICCGISTGTSSSQGSHEVPVINSEPALESKPEPQDTQEEEATMVSE

    • Sequence Length

    • 72

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03295 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03295.

Physicochemical Information

    • Formula

    • C314H520N90O116S7

    • Absent Amino Acids

    • FW

    • Common Amino Acids

    • S

    • Mass

    • 7636.54

    • PI

    • 5.3

    • Basic Residues

    • 9

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 13

    • Net Charge

    • -1

    • Boman Index

    • -146.39

    • Hydrophobicity

    • -0.686

    • Aliphatic Index

    • 52.78

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 26.27

    • Polar Residues

    • 30

DRAMP03295

DRAMP03295 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity (By similarity).

    • Tissue specificity

    • Highly expressed in kidney, lowly expressed in spleen, and expressed at lower levels in lung.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Defensins and the convergent evolution of platypus and reptile venom genes.

    • Reference

    • Genome Res. 2008 Jun;18(6):986-994.

    • Author

    • Whittington CM, Papenfuss AT, Bansal P, Torres AM, Wong ES, Deakin JE, Graves T, Alsop A, Schatzkamer K, Kremitzki C, Ponting CP, Temple-Smith P, Warren WC, Kuchel PW, Belov K.
  • ·Literature 2

    • Title

    • Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.

    • Reference

    • Toxicon. 2008 Sep 15;52(4):559-565.

    • Author

    • Whittington CM, Papenfuss AT, Kuchel PW, Belov K.