General Information

    • DRAMP ID

    • DRAMP03303

    • Peptide Name

    • Theromyzin (Frogs, amphibians, animals)

    • Source

    • Theromyzon tessulatum (Duck leech)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DHHHDHGHDDHEHEELTLEKIKEKIKDYADKTPVDQLTERVQAGRDYLLGKGARPSHLPARVDRHLSKLTAAEKQELADYLLTFLH

    • Sequence Length

    • 86

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Micrococcus luteus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03303 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03303.

Physicochemical Information

    • Formula

    • C438H688N132O136

    • Absent Amino Acids

    • CMNW

    • Common Amino Acids

    • L

    • Mass

    • 9979.08

    • PI

    • 6.03

    • Basic Residues

    • 23

    • Acidic Residues

    • 18

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +5

    • Boman Index

    • -243.56

    • Hydrophobicity

    • -1.07

    • Aliphatic Index

    • 81.74

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4470

    • Absorbance 280nm

    • 52.59

    • Polar Residues

    • 14

DRAMP03303

DRAMP03303 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular characterization of two novel antibacterial peptides inducible upon bacterial challenge in an annelid, the leech Theromyzon tessulatum.

    • Reference

    • J Biol Chem. 2004 Jul 23;279(30):30973-30982.

    • Author

    • Tasiemski A, Vandenbulcke F, Mitta G, Lemoine J, Lefebvre C, Sautière PE, Salzet M.