General Information

    • DRAMP ID

    • DRAMP03307

    • Peptide Name

    • Duck AvBD9 (avian beta defensin 9; Birds, animals)

    • Source

    • Anas platyrhynchos (Peking duck)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Escherichia coli, Staphylococcus aureus, Pasteurella multocida, Salmonella choleraesuis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03307 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03307.

Physicochemical Information

    • Formula

    • C183H299N59O57S6

    • Absent Amino Acids

    • EMNY

    • Common Amino Acids

    • CS

    • Mass

    • 4430.11

    • PI

    • 8.94

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -72.43

    • Hydrophobicity

    • -0.157

    • Aliphatic Index

    • 53.57

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 143.29

    • Polar Residues

    • 17

DRAMP03307

DRAMP03307 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Two novel duck antibacterial peptides, avian beta-defensins 9 and 10, with antimicrobial activity.

    • Reference

    • J Microbiol Biotechnol. 2009 Nov;19(11):1447-1455.

    • Author

    • Ma D, Liao W, Wang R, Han Z, Liu S.