General Information

    • DRAMP ID

    • DRAMP03316

    • Peptide Name

    • Defensin (Insects, animals)

    • Source

    • Palomena prasina (Green shield bug)

    • Family

    • Belongs to the invertebrate defensin family (Type 1 subfamily)

    • Gene

    • Not found

    • Sequence

    • ATCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03316 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03316.

Physicochemical Information

    • Formula

    • C195H313N61O59S6

    • Absent Amino Acids

    • EMPQ

    • Common Amino Acids

    • C

    • Mass

    • 4648.36

    • PI

    • 8.92

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +6

    • Boman Index

    • -59.38

    • Hydrophobicity

    • -0.005

    • Aliphatic Index

    • 68.14

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 175.36

    • Polar Residues

    • 22

DRAMP03316

DRAMP03316 chydropathy plot

Comments Information

    • Function

    • Antibacterial peptide active against Gram-negative bacteria.

    • Induction

    • By bacterial infection.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The inducible antibacterial peptides of the hemipteran insect Palomena prasina: identification of a unique family of proline-rich peptides and of a novel insect defensin

    • Reference

    • J. Insect Physiol. 1996;42:81-89.

    • Author

    • Chernysh S, Cociancich S, Briand JP, Hetru C, Bulet P.